Loading...
Statistics
Advertisement

Best Buy Travels & Tours
www.bestbuytravelmart.com/

Bestbuytravelmart.com

Advertisement
Bestbuytravelmart.com is hosted in United States / Tempe . Bestbuytravelmart.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Font Awesome, Google Font API, Number of used javascripts: 2. First javascripts: Jquery.js, Bootstrap.min.js, Number of used analytics tools: 0. Its server type is: nginx admin.

Technologies in use by Bestbuytravelmart.com

Technology

Number of occurences: 6
  • CSS
  • Font Awesome
  • Google Font API
  • Html
  • Html5
  • jQuery

Advertisement

Javascripts

Number of occurences: 2
  • jquery.js
  • bootstrap.min.js

Server Type

  • nginx admin

CDN

Number of occurences: 2
  • Maxcdn
  • OSS CDN

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Bestbuytravelmart.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL/CN=www.benignsol.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL
      • CN: www.benignsol.com
    • hash: 0cd3cf8c
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 67861932904990507150443157766724303442
    • validFrom: 141217000000Z
    • validTo: 151217235959Z
    • validFrom_time_t: 1418774400
    • validTo_time_t: 1450396799
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 9C:3C:78:03:81:9C:44:59:44:3A:E3:7A:98:3B:42:A0:97:38:33:B2
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:www.benignsol.com, DNS:benignsol.com

Meta - Bestbuytravelmart.com

Number of occurences: 4
  • Name:
    Content: IE=edge
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: description
    Content:
  • Name: author
    Content:

Server / Hosting

  • IP: 69.160.32.58
  • Latitude: 33.37
  • Longitude: -111.94
  • Country: United States
  • City: Tempe

Rname

  • ns2.hostingkraft.net
  • ns1.hostingkraft.net
  • bestbuytravelmart.com

Target

  • iakhan.technokraft.net

HTTP Header Response

HTTP/1.1 200 OK Server: nginx admin Date: Wed, 21 Sep 2016 09:15:19 GMT Content-Type: text/html Content-Length: 5028 Vary: Accept-Encoding Last-Modified: Sun, 19 Jun 2016 23:53:02 GMT X-Cache: HIT from Backend Accept-Ranges: bytes X-Cache: MISS from s_hv897 Via: 1.1 s_hv897 (squid/3.5.20) Connection: keep-alive

DNS

host: bestbuytravelmart.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 69.160.32.58
host: bestbuytravelmart.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.hostingkraft.net
host: bestbuytravelmart.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.hostingkraft.net
host: bestbuytravelmart.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.hostingkraft.net
  5. rname: iakhan.technokraft.net
  6. serial: 2016051302
  7. refresh: 3600
  8. retry: 7200
  9. expire: 1209600
  10. minimum-ttl: 86400
host: bestbuytravelmart.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: bestbuytravelmart.com
host: bestbuytravelmart.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 ip4:69.160.32.58 +a +mx +ip4:131.153.5.98 ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.estbuytravelmart.com, www.bqestbuytravelmart.com, www.qestbuytravelmart.com, www.bwestbuytravelmart.com, www.westbuytravelmart.com, www.bzestbuytravelmart.com, www.zestbuytravelmart.com, www.bxestbuytravelmart.com, www.xestbuytravelmart.com, www.bestbuytravelmart.com, www.estbuytravelmart.com, www.bsestbuytravelmart.com, www.sestbuytravelmart.com, www.byestbuytravelmart.com, www.yestbuytravelmart.com, www.beestbuytravelmart.com, www.eestbuytravelmart.com, www.bdestbuytravelmart.com, www.destbuytravelmart.com, www.bcestbuytravelmart.com, www.cestbuytravelmart.com, www.bstbuytravelmart.com, www.bexstbuytravelmart.com, www.bxstbuytravelmart.com, www.besstbuytravelmart.com, www.bsstbuytravelmart.com, www.bewstbuytravelmart.com, www.bwstbuytravelmart.com, www.berstbuytravelmart.com, www.brstbuytravelmart.com, www.befstbuytravelmart.com, www.bfstbuytravelmart.com, www.bevstbuytravelmart.com, www.bvstbuytravelmart.com, www.becstbuytravelmart.com, www.bcstbuytravelmart.com, www.beqstbuytravelmart.com, www.bqstbuytravelmart.com, www.beastbuytravelmart.com, www.bastbuytravelmart.com, www.beystbuytravelmart.com, www.bystbuytravelmart.com, www.betbuytravelmart.com, www.besetbuytravelmart.com, www.beetbuytravelmart.com, www.beswtbuytravelmart.com, www.bewtbuytravelmart.com, www.besdtbuytravelmart.com, www.bedtbuytravelmart.com, www.besxtbuytravelmart.com, www.bextbuytravelmart.com, www.besftbuytravelmart.com, www.beftbuytravelmart.com, www.besgtbuytravelmart.com, www.begtbuytravelmart.com, www.besttbuytravelmart.com, www.bettbuytravelmart.com, www.besbuytravelmart.com, www.bestqbuytravelmart.com, www.besqbuytravelmart.com, www.bestabuytravelmart.com, www.besabuytravelmart.com, www.best buytravelmart.com, www.bes buytravelmart.com, www.bestwbuytravelmart.com, www.beswbuytravelmart.com, www.bestebuytravelmart.com, www.besebuytravelmart.com, www.bestzbuytravelmart.com, www.beszbuytravelmart.com, www.bestxbuytravelmart.com, www.besxbuytravelmart.com, www.bestcbuytravelmart.com, www.bescbuytravelmart.com, www.bestuytravelmart.com, www.bestbquytravelmart.com, www.bestquytravelmart.com, www.bestbwuytravelmart.com, www.bestwuytravelmart.com, www.bestbzuytravelmart.com, www.bestzuytravelmart.com, www.bestbxuytravelmart.com, www.bestxuytravelmart.com, www.bestbuytravelmart.com, www.bestuytravelmart.com, www.bestbsuytravelmart.com, www.bestsuytravelmart.com, www.bestbyuytravelmart.com, www.bestyuytravelmart.com, www.bestbeuytravelmart.com, www.besteuytravelmart.com, www.bestbduytravelmart.com, www.bestduytravelmart.com, www.bestbcuytravelmart.com, www.bestcuytravelmart.com, www.bestbytravelmart.com, www.bestbuwytravelmart.com, www.bestbwytravelmart.com, www.bestbueytravelmart.com, www.bestbeytravelmart.com, www.bestbusytravelmart.com, www.bestbsytravelmart.com, www.bestbuaytravelmart.com, www.bestbaytravelmart.com, www.bestbutravelmart.com, www.bestbuyztravelmart.com, www.bestbuztravelmart.com, www.bestbuyatravelmart.com, www.bestbuatravelmart.com, www.bestbuystravelmart.com, www.bestbustravelmart.com, www.bestbuydtravelmart.com, www.bestbudtravelmart.com, www.bestbuytravelmart.com, www.bestbutravelmart.com, www.bestbuyctravelmart.com, www.bestbuctravelmart.com, www.bestbuy travelmart.com, www.bestbu travelmart.com, www.bestbuyravelmart.com, www.bestbuytqravelmart.com, www.bestbuyqravelmart.com, www.bestbuytaravelmart.com, www.bestbuyaravelmart.com, www.bestbuyt ravelmart.com, www.bestbuy ravelmart.com, www.bestbuytwravelmart.com, www.bestbuywravelmart.com, www.bestbuyteravelmart.com, www.bestbuyeravelmart.com, www.bestbuytzravelmart.com, www.bestbuyzravelmart.com, www.bestbuytxravelmart.com, www.bestbuyxravelmart.com, www.bestbuytcravelmart.com, www.bestbuycravelmart.com, www.bestbuytavelmart.com, www.bestbuytriavelmart.com, www.bestbuytiavelmart.com, www.bestbuytroavelmart.com, www.bestbuytoavelmart.com, www.bestbuytrlavelmart.com, www.bestbuytlavelmart.com, www.bestbuytrlavelmart.com, www.bestbuytlavelmart.com, www.bestbuytr.avelmart.com, www.bestbuyt.avelmart.com, www.bestbuytrvelmart.com, www.bestbuytraovelmart.com, www.bestbuytrovelmart.com, www.bestbuytrapvelmart.com, www.bestbuytrpvelmart.com, www.bestbuytra9velmart.com, www.bestbuytr9velmart.com, www.bestbuytravelmart.com, www.bestbuytrvelmart.com, www.bestbuytraivelmart.com, www.bestbuytrivelmart.com, www.bestbuytrauvelmart.com, www.bestbuytruvelmart.com, www.bestbuytraelmart.com, www.bestbuytravyelmart.com, www.bestbuytrayelmart.com, www.bestbuytravzelmart.com, www.bestbuytrazelmart.com, www.bestbuytravhelmart.com, www.bestbuytrahelmart.com, www.bestbuytravnelmart.com, www.bestbuytranelmart.com, www.bestbuytravmelmart.com, www.bestbuytramelmart.com, www.bestbuytravjelmart.com, www.bestbuytrajelmart.com, www.bestbuytravkelmart.com, www.bestbuytrakelmart.com, www.bestbuytravielmart.com, www.bestbuytraielmart.com,

Other websites we recently analyzed

  1. San Diego Employment Law And Business Law Attorney | Palm Springs CA
    Contact Donald R. Holben & Associates, APC, in San Diego, California, at 619-780-2820 for legal advice and representation.
    Europe - 2.20.188.249
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript, Php, Omniture, SiteCatalyst
    Number of Javascript: 9
    Number of meta tags: 16
  2. Angela Mercedes Donna Otto's Portfolio
    Germany - 89.107.184.29
    Server software: nginx/1.2.1
    Technology: CSS, Html, Javascript, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 1
  3. Ассоциация служб такси российской федерации
    Nürnberg (Germany) - 88.198.0.162
    Server software: nginx/1.8.1
    Technology: Maxcdn, OSS CDN, CSS, Html, Html5, Javascript, jQuery, Yandex.Metrika
    Number of Javascript: 4
    Number of meta tags: 2
  4. AWAY REALTY | Лучшее агентство зарубежной недвижимости
    HOMES.RU - AWAY REALTY: Элитная зарубежная недвижимость, элитная недвижимость за рубежом, продажа домов за рубежом, квартира, апартаменты, вилла, пентхаус, коттедж, таунхаус, особняк, дача, бунгало, офис, земля, земельный участок, страны мира, Европа, острова, экзотика, правовая информация, визы, описание страны по недвижимости, Австрия, Великобритания, Германия, Испания, Италия, Португалия, Франция, Хорватия, Черногория.
    Netherlands - 109.206.190.54
    Server software: nginx/1.10.1
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Yandex.Metrika
    Number of Javascript: 4
    Number of meta tags: 5
  5. sariyerevdenevenakliyatfirmalari.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
    Cyprus - 93.89.226.17
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html
  6. Riverlands Equestrian - Welcome
    Riverlands Equestrian Facility
    San Francisco (United States) - 199.34.228.58
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 5
    Number of meta tags: 4
  7. Cirurgica Jundiaiense
    This is where the page description goes make sure you change this as it is important for search engines.
    Brazil - 187.17.111.98
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript
    Number of Javascript: 7
    Number of meta tags: 3
  8. Welcome to ONLINECHEQUING.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  9. sabaymerlman.com
    Provo (United States) - 50.87.110.109
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, SVG, Wordpress
    Number of Javascript: 8
    Number of meta tags: 3
  10. 本域名出售、转让、出租
    Mesquite (United States) - 23.226.77.61
    Server software: IIS
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 1

Check Other Websites